Protein Info for GFF1510 in Sphingobium sp. HT1-2

Annotation: FIG123464: Polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02563: Poly_export" amino acids 44 to 117 (74 residues), 75.2 bits, see alignment E=5.8e-25 PF22461: SLBB_2" amino acids 126 to 209 (84 residues), 36.2 bits, see alignment E=8.2e-13 PF10531: SLBB" amino acids 128 to 178 (51 residues), 29.6 bits, see alignment E=7.5e-11

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 85% identity to sch:Sphch_1238)

Predicted SEED Role

"FIG123464: Polysaccharide export protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF1510 FIG123464: Polysaccharide export protein (Sphingobium sp. HT1-2)
MRFQRISRLLIGASLPAVALSGCASTGSAPQLPPASFVATQEGPGEEYIIGPLDNLTIFV
WRNPELGAKVQVRPDGRITTPLITDMPAVGKTPKMLSDDIKLALTQYIENPLVSVIVDNF
SGTYSQQVRIVGATEKPASIPYRANMTLLDAMISVGGLSEYASGNRARLVRFDKASGKQK
EYQVRIGDLLKKGDTKANVMLAPGDVIIIPESMF