Protein Info for PS417_07640 in Pseudomonas simiae WCS417
Annotation: glyceraldehyde-3-phosphate dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to GAP2_PSEAB: Glyceraldehyde-3-phosphate dehydrogenase-like protein (gap2) from Pseudomonas aeruginosa (strain UCBPP-PA14)
KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to pfs:PFLU1566)Predicted SEED Role
"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.13)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (16/17 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
- gluconeogenesis I (11/13 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- Bifidobacterium shunt (12/15 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis III (from glucose) (9/11 steps found)
- heterolactic fermentation (14/18 steps found)
- glycolysis IV (8/10 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- homolactic fermentation (9/12 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- gluconeogenesis III (8/12 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- superpathway of hexitol degradation (bacteria) (12/18 steps found)
- oxygenic photosynthesis (11/17 steps found)
- glycerol degradation to butanol (10/16 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Glycolysis / Gluconeogenesis
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.12
Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7TVU2 at UniProt or InterPro
Protein Sequence (487 amino acids)
>PS417_07640 glyceraldehyde-3-phosphate dehydrogenase (Pseudomonas simiae WCS417) MWKVPVTQKPDQCLGEWIDREALAEAMIPLIGQLYRNNNVVSSIYGRSLINQSVIAILKA HRFARHRSADDSELSVHETFPLLKAMSELKLGAASVDLGKLAYKFRKEGAGRTAEQFVRE EMADVVGQQNAAARKGTDVVLYGFGRIGRLLARILIEKTGGGDGLRLRAIVVRKGAENDL TKRASLLRRDSVHGPFNGTIVIDEENNTITANGNLIQVIYAKNPSEVDYTQYGIKDALLV DNTGVWRDAEGLGQHLACPGVDRVVLTAPGKGKLKNIVHGINHAEITADDKIVSAASCTT NAIVPVLKAVNDKFGIVNGHVETVHSYTNDQNLIDNFHKGDRRGRSAALNMVITETGAAT AAAKALPELAGKLTGNAIRVPTPNVSMAILNLNLEKAATREEMNEYLRYMALHSDLHKQI DFVNSQEVVSTDFVGSRHAGVVDAEATITQDNRVVLYVWYDNEFGYSCQVVRVMEDMAGV NPPAFPR