Protein Info for GFF1499 in Sphingobium sp. HT1-2

Annotation: Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 26 to 454 (429 residues), 332.1 bits, see alignment E=3.5e-103 PF02397: Bac_transf" amino acids 263 to 451 (189 residues), 222.9 bits, see alignment E=1.1e-70

Best Hits

KEGG orthology group: None (inferred from 84% identity to sch:Sphch_1228)

Predicted SEED Role

"exopolysaccharide production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>GFF1499 Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6) (Sphingobium sp. HT1-2)
MIMQGASLTVSKEIVRLRLYALCLAGDMAGLFIAFLLANWLVVGAFLGEPGKPHGLVMFS
MVAPLYAILAVQGGAYGINTLDRVRRGIFRALLALAQAALLMLLIVYLGKIAEQLSRLTF
LTGLLLGAATLALVRLAVARLAVRLLGDVPHLTAVIMDGVAIETGAHMEVIQADAANLHP
ERHDADMAARLAAAVGMAERVIVACPLERMDDWSAALKSLSARGEIVVPELLRFAPARVD
EFDGQPTIIVAGGPLQFRDRLIKRLFDIIVATIATIALSPVLFGAALAVKLTSPGPILFR
QPRIGKDGRPFSIYKFRSMRTEASDHKAATLTRRDDDRVTRIGAFLRKTSIDELPQLFNV
LNGDMSVVGPRPHAAAAKAGDSLYWEVDARYWERHCIKPGMTGLAQVRGHRGATDHHQDL
IDRLQSDLEYVSDWSIWRDLRIIVATLGVLVHHKAY