Protein Info for GFF1497 in Xanthobacter sp. DMC5

Annotation: NADPH-dependent reductase BacG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00106: adh_short" amino acids 8 to 193 (186 residues), 133 bits, see alignment E=1.5e-42 PF08659: KR" amino acids 9 to 167 (159 residues), 44.8 bits, see alignment E=2.1e-15 PF13561: adh_short_C2" amino acids 14 to 252 (239 residues), 129.3 bits, see alignment E=2.8e-41

Best Hits

KEGG orthology group: None (inferred from 89% identity to azc:AZC_2443)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF1497 NADPH-dependent reductase BacG (Xanthobacter sp. DMC5)
LKLDLTEKTALITGASKGIGLATARVFAQEGCHLHLAARNGEALAEAKAEIEAAHGVKVS
IYAVDLGSTQAMEKLAADVGDVDILVNNAGDIPAGSLDVVDDAAWRRGFDLKVFGYITLS
RAYYSRMRGKDGVIVNVIGNSGENWDASYIAGSTGNAALMSFTKALGGASLNDGVRVVGV
NPGPVATDRMLKIMKRKAIDMLGAEERWEELFDKYPGKRPATAEEVADLVAFLASPRAGY
ITGTNVTIDGGISARGSVI