Protein Info for GFF1496 in Sphingobium sp. HT1-2

Annotation: hypothetical protein; putative membrane protein, putative permease of the major facilitator superfamily (COG0477)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 263 to 279 (17 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 77% identity to sch:Sphch_1225)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF1496 hypothetical protein; putative membrane protein, putative permease of the major facilitator superfamily (COG0477) (Sphingobium sp. HT1-2)
MEASARILALVKLANVGLVMIWGFAVTFVFVRVLPLAEFQAFLLLVAFGNFTISAEFGLT
SIIYARLRRFWLGSDEEAADGGFRLEEMGVLFLFLGLLIAGAVAILLGALALGGLHTAMP
MLFLLFFLTACLNLPALLAKRALAAIDGNFLWEGLDCARRLVTIGLLAAILFGLDPRLSV
ALQLAISVLVIGYAIVHVHRRLSMRRSHWFAFRVGGGHVRRHYLRDIGASAAFTVSDIVA
YNAPYFTIAMATSDARPMLLFDFFFKMSRSLSMLVRAMVEAALPRITRAYHAGESGRVRQ
LLTRALGAALFFALAGSALLMLIGRWLFDKLFDGRAAIDQADLGLTALALVALSVICVSV
YVQAALGRFAHLLQRSLPFLAGSLLSVPLAGAFWPDRFDLGFLGLYALTLMLAAGLHLVS
LRRLVRA