Protein Info for GFF1493 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 408 to 425 (18 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 85% identity to sch:Sphch_1222)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (580 amino acids)

>GFF1493 hypothetical protein (Sphingobium sp. HT1-2)
MPKGMPFVSARRLFLAGAIGLALWLGATFLWHVTWRQGVSLAVILFLDQDFPALMIGLFL
LALAAPFAEGMGFRLPQPRARIIVPIIVLLGLAAWAGHYALFQDYSVSRDEEVARFAAAY
MREGLFARPIPVEWEPYRRAIMPEFFSPFGAADYWTAAYLPVNSAIQALFWQMGDPNLAG
PVLLVLGLFSLWRVALHLFPDRPDAVWVTMLLGLSSAQLWVTAMTPYAMTGHFALNMVWL
ALVLRGGIAGHLSAGVVALIAAGLHQWHFPPIFIAPFILWMLLARRWTVAAFHALTLVAI
VIVWAKIWPGFLLHALGAPTDVRPSAGVADKVGSLFQRLGDRWQPLVNLSRYAAWNNILM
VPLAGLGVLAMRWRDAIRGREIALPLALGCLAGCALALAQGYGWGFRYAHGFIGPFCLLG
GLGWARFRPQGTMRPVFIGFVVTLLTAGFLVWRTHVFVEPYAASHRMIDASRADVVLVDP
RGGLYVTDLVRGRNGVPGKPMVMNLGMLTLDQVDELCKTYVVELFDRAEFRPLGVPLARW
NLGRMDTLRAHMKLAGCDRPVQPPLPETIDDAMNAADNAM