Protein Info for GFF1488 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF13188: PAS_8" amino acids 8 to 40 (33 residues), 15.5 bits, see alignment (E = 4.7e-06) amino acids 139 to 179 (41 residues), 23.6 bits, see alignment 1.3e-08 amino acids 264 to 316 (53 residues), 19.6 bits, see alignment 2.3e-07 PF12860: PAS_7" amino acids 13 to 116 (104 residues), 36 bits, see alignment E=2.4e-12 amino acids 140 to 249 (110 residues), 28.4 bits, see alignment E=5.6e-10 PF13426: PAS_9" amino acids 145 to 190 (46 residues), 13.4 bits, see alignment 2.8e-05 amino acids 284 to 379 (96 residues), 14.5 bits, see alignment E=1.3e-05 TIGR00229: PAS domain S-box protein" amino acids 262 to 389 (128 residues), 51 bits, see alignment E=1.6e-17 PF00989: PAS" amino acids 265 to 324 (60 residues), 30.2 bits, see alignment 1.4e-10 PF08447: PAS_3" amino acids 288 to 361 (74 residues), 31 bits, see alignment E=8.7e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 398 to 564 (167 residues), 161.3 bits, see alignment E=1.7e-51 PF00990: GGDEF" amino acids 401 to 560 (160 residues), 149.2 bits, see alignment E=3.3e-47

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>GFF1488 hypothetical protein (Xanthobacter sp. DMC5)
VTGRHFDFFADLLDGIDMALCLFDADDRCLSWNNTFLKFFPEHDGHVHVGEPYAANLRRF
YAARLDATEQANIERYIRDGVQRHRTQSRPFVFDHRGRRLRVNAQTTAEGNRVRIWQALA
PEPVGSERSDAQRGFSIDLLDHIPDGAMVLDQNDLIIAANDEFRRMYGVRPGETVVGQTF
AAVVRRAWAAAGRPDEPLDPGLLDNMRFAGSPFEIELPRDQWRRVMARRTSDGIGYFTHS
DISLLKRQQADLLVAERRAWEGERRYRLLAENSTDVIAAISGDRTIRFMSPACSRILGWG
PSEMLDRDVIDFLHPDEQPMFLAALCAGEGSGLGRSAAFVCRVRARHDDWVWMEASIGTV
RETTLDGADIAFVCSLRDARERVLAERALKRAHEELALIASSDPLTGLANRRRFETIFDQ
EWHRAERDRHGLCLAMVDIDHFKGVNDTFGHLVGDECLRRVAMVIKANLPPSVGLAARYG
GEEFVLLLPNTSAVQGQALCARIHDDLQREPWSAVAPGLDRVTVSIGLCIARAPQEASMA
GLIRIADEALYRAKSSGRNRTEVQHAV