Protein Info for GFF1486 in Xanthobacter sp. DMC5

Annotation: sn-glycerol-3-phosphate transport system permease protein UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details amino acids 31 to 34 (4 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 67 to 95 (29 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 154 to 289 (136 residues), 52.7 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 54% identical to UGPA_BRUSU: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 57% identity to mno:Mnod_1266)

MetaCyc: 48% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF1486 sn-glycerol-3-phosphate transport system permease protein UgpA (Xanthobacter sp. DMC5)
MERRTIFPGWTVPALLLVPQMALTVLFFLWPTAVAVRASVMRADPFGLSETFTGLDNFTA
LFTDPLYLAAIGRTLVFCGAVTGLALGLAVLQAVFADADIRGRGAYRAALVWPYAVAPAA
AGVIWALLLHPQIGGVASLLKHLGIAWNYKLNDTQAMVAVVGASAWRQVSYNFIFVLAGL
QSIPRTIIDAARMDGARGWRRFRTILLPMLAPTLAFLVVVNLVYSAFETFGTIEALTQGG
PGQATQTLMVKVYRDGVVNLDLGASAAQSVVLMVLVMGLTALQFHFLRRRGER