Protein Info for GFF1484 in Sphingobium sp. HT1-2

Annotation: Free methionine-(R)-sulfoxide reductase, contains GAF domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13185: GAF_2
  • amino acids 51 to 157 (107 residues), 57.9 bits, E=1.3e-19
• PF01590: GAF
  • amino acids 53 to 159 (107 residues), 55.5 bits, E=9.2e-19

Best Hits

Swiss-Prot: 52% identical to Y507_ZYMMO: Protein ZMO0507 (ZMO0507) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 79% identity to sjp:SJA_C1-15260)

MetaCyc: 56% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Protein Sequence (161 amino acids)

>GFF1484 Free methionine-(R)-sulfoxide reductase, contains GAF domain (Sphingobium sp. HT1-2)
MYDFAPAADADKATLYADLLSAADALTRDEPDAVANMANLSALIWQFLPDLNWAGFYRMV
EDELVLGPFQGKAACIRIPLGRGVCGTAAQTRETQLVADVHAFPGHIACDAASASEIVVP
VVHDGRLIGVLDLDSPRPARFDSADQQGLEELVARIAGRIG