Protein Info for GFF1480 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 304 (289 residues), 63.5 bits, see alignment E=9.4e-22

Best Hits

KEGG orthology group: None (inferred from 69% identity to sjp:SJA_C1-15290)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF1480 hypothetical protein (Sphingobium sp. HT1-2)
MENRGLAYQHAPQRLDWVDVARGIGIIAVVVGHVWTRGALRDAMYSFHMPLFFLLSGMLS
RPHPVGPFTRRQLLGQLRPYTIFLALLILADQIIEPAKGNLPIFHQWPRDLLPILLGGYW
LRGPYTIFWFVPCLMLARILFNLALNRWPDPRDRRWLILMPGLLVLAEGLGWMTPASPLG
LLSVPMAMILLWVGALWPRLHWRNLWIAPLGLLALAGLAGWLPTLNMKAADYGWPLLSIG
SGIATSLLLFRLSARLAPVAAPLAALGRASLVIMYLHVAIIHYGTPYLARPWLLALALLT
PFALWHLIRLSPRLSRWML