Protein Info for GFF148 in Xanthobacter sp. DMC5

Annotation: DNA damage-inducible protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 21 to 413 (393 residues), 199.1 bits, see alignment E=5.5e-63 PF01554: MatE" amino acids 21 to 180 (160 residues), 58.9 bits, see alignment E=2.7e-20 amino acids 253 to 396 (144 residues), 51.8 bits, see alignment E=4e-18

Best Hits

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 79% identity to xau:Xaut_1467)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF148 DNA damage-inducible protein F (Xanthobacter sp. DMC5)
VSLAAVSGDVTHRRVLAIALPMTLAHLTTPLLGVVDAAVVGRLGSASMLGGVALAAVIFD
MLFWVFGFLRMGTVGLAAQAVGRRDAVEERAVLARGLLVAGALGLLIVLLRTPIESAALS
LAGASDEVNVAVRDYYAVRIFAAPFTLANYVVLGWLVGLGRTGRALALQVGINFLNMVLS
AALVLGAGWGVAGSAAGTLVAEIAGAVAGLILCAALLGGRLGVAKAVLLDKARLSQTVML
NRDIMIRTAALMFAFSFFAAQGARAGDVTLAANAILQNMVMVAAYFLDGFATAAEQICGS
AVGARRKSDFSAGVRLSIVWGFVFAVLAGVVYLVTGPAIVDAMSTSPEVRAEARIYLLYA
ALLPVAGVTAYAFDGVYIGALWSRDMRNLMIASLVVYLAVFLALRPLGNHGLWLAMLAFL
LARGGFQALRLPALVRRTFG