Protein Info for GFF148 in Sphingobium sp. HT1-2

Annotation: ATP-dependent protease subunit HslV (EC 3.4.25.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 13 to 183 (171 residues), 92.2 bits, E=1.7e-30
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 15 to 184 (170 residues), 273.4 bits, E=3.4e-86

Best Hits

Swiss-Prot: 87% identical to HSLV_ZYMMO: ATP-dependent protease subunit HslV (hslV) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 93% identity to sjp:SJA_C1-16930)

MetaCyc: 63% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (188 amino acids)

>GFF148 ATP-dependent protease subunit HslV (EC 3.4.25.2) (Sphingobium sp. HT1-2)
MNDHNRSSMPVWHGTTIMSVRKNGKVVVAGDGQVSMGQTVMKPNARKVRRLHDGSVIGGF
AGATADAFTLFERLEAKLERHNGQLMRAAVELAKDWRTDKYLRNLEAMMIVADKDVTLIL
TGNGDVLEPLGGVAAIGSGGNYALAAARALVEYEEDAETLARKAMGVAADICVYTNDQLT
IETLDSAN