Protein Info for PS417_07520 in Pseudomonas simiae WCS417

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF18125: RlmM_FDX" amino acids 1 to 70 (70 residues), 71.4 bits, see alignment E=1e-23 PF21239: RLMM_N" amino acids 82 to 157 (76 residues), 60.6 bits, see alignment E=1.8e-20 PF01728: FtsJ" amino acids 181 to 273 (93 residues), 35.9 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 98% identical to RLMM_PSEFS: Ribosomal RNA large subunit methyltransferase M (rlmM) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 98% identity to pfs:PFLU1543)

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ78 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PS417_07520 23S rRNA methyltransferase (Pseudomonas simiae WCS417)
MNTLFMHCRPGFEGEVCSEIAEHAARLNVSGYAKAKTGSACAEFVCTEEDGAQRLMHGQR
FAELIFPRQWARGVFIDLPETDRISVILAHLREFPVCGSLWLEMVDTNDGKELSNFCKKF
EVHLRKALLNAGTLVDDPSKPRLLLTFKSGREVFMGLAESNNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTFVPKQPVDWMVCDIVEKPARNAALLETWIGEGYCREAVVNLK
LPMKQRYAEVKRLLERIEDGFKARGVRVEIGCKQLYHDREEVTCHLRRLVDVKKTKAR