Protein Info for GFF1478 in Sphingobium sp. HT1-2

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 196 (190 residues), 175.1 bits, E=2.4e-55
• PF08659: KR
  • amino acids 10 to 157 (148 residues), 30.8 bits, E=5.6e-11
• PF13561: adh_short_C2
  • amino acids 15 to 245 (231 residues), 210.7 bits, E=4.9e-66

Best Hits

Swiss-Prot: 39% identical to BACC_BACSU: Dihydroanticapsin 7-dehydrogenase (bacC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 60% identity to mes:Meso_2224)

MetaCyc: 39% identical to dihydroanticapsin dehydrogenase (Bacillus subtilis)
RXN-16285 [EC: 1.1.1.385]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• stearate biosynthesis IV (3/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• bacilysin biosynthesis (2/10 steps found)
• tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
• mycolate biosynthesis (23/205 steps found)
• superpathway of mycolate biosynthesis (24/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.385

Protein Sequence (248 amino acids)

>GFF1478 Oxidoreductase, short-chain dehydrogenase/reductase family (Sphingobium sp. HT1-2)
MALFKDRVAIVTGGASGIGEAVVKDLLAEGAKVVIADFDEAGAQRLAQSCGADRARAFKV
DVSDAQAVSASVDFAVETFGGLHLAVNNAGIGAPSTPLADIAIDDWHRVVGVDLHSVFYG
MKYQIPAMLKSGGGAIVNMASILGAVGWAGSAAYVTSKHAVVGMTKTAALDYAGQGIRVN
AVGPAFVETPALGKTMTDAERAVLAGLHAFDRLARPEEIAAMTSFLLSDRASFMTGTYYP
VDGGYLAR