Protein Info for GFF1477 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF03705: CheR_N" amino acids 29 to 80 (52 residues), 63.3 bits, see alignment 3.3e-21 PF01739: CheR" amino acids 95 to 279 (185 residues), 186.1 bits, see alignment E=1.3e-58 PF13649: Methyltransf_25" amino acids 208 to 258 (51 residues), 32.2 bits, see alignment 3.6e-11 PF08241: Methyltransf_11" amino acids 214 to 262 (49 residues), 34.3 bits, see alignment 7.4e-12

Best Hits

Swiss-Prot: 56% identical to CHER_SALTY: Chemotaxis protein methyltransferase (cheR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 73% identity to aaa:Acav_4273)

MetaCyc: 53% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF1477 Chemotaxis protein methyltransferase CheR (EC 2.1.1.80) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VFLEKGSAPRAAPEDGPLTEGREFVWSNDDFTRIKALIYKKAGISLHDGKHAMVYSRVSR
RLRETGHDSFKTYLDWLEKHDGAEWQEFINALTTNLTAFFRESHHFGILNDLLAAKRTQA
WRIWCSAASTGEEPYSIAMTATEALGASGSFQIVNSDIDTKVLATAQRGIYKADGVKGLS
PERLQRFFMRGKAGNAGLMRVKPELQKHMEFLSVNLIENLPFRDPFDVVFCRNVMIYFDA
ATQRAVLERIHRVMKPGGMLFVGHAENFSDARNLFVLRGKTVYERI