Protein Info for GFF1476 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Melibiose carrier protein, Na+/melibiose symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 349 (26 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 8 to 450 (443 residues), 572.5 bits, see alignment E=2.5e-176 PF13347: MFS_2" amino acids 10 to 436 (427 residues), 278.3 bits, see alignment E=4.6e-87

Best Hits

Swiss-Prot: 100% identical to MELB_SALTY: Melibiose carrier protein (melB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11104, melibiose permease (inferred from 99% identity to seg:SG4144)

MetaCyc: 85% identical to melibiose:H+/Na+/Li+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-17755; TRANS-RXN-94; TRANS-RXN-94A; TRANS-RXN-94B; TRANS-RXN0-519; TRANS-RXN0-520

Predicted SEED Role

"Melibiose carrier protein, Na+/melibiose symporter" in subsystem Melibiose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>GFF1476 Melibiose carrier protein, Na+/melibiose symporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSISLTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINDP
IMGWIVNATRSRWGKFKPWILIGTLTNSLVLFLLFSAHLFEGTAQVVFVCVTYILWGMTY
TIMDIPFWSLVPTITLDKREREQLVPFPRFFASLAGFVTAGITLPFVSYVGGADRGFGFQ
MFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTIVGLIYKNDQLSCLLGMA
LAYNIASNIINGFAIYYFTYVIGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWA
GASVMPVLSCAGLFAMALADIHNAALIVAAGIFLNIGTALFWVLQVIMVADTVDYGEFKL
NIRCESIAYSVQTMVVKGGSAFAAFFIALVLGLIGYTPNVAQSAQTLQGMQFIMIVLPVL
FFMMTLVLYFRYYRLNGDMLRKIQIHLLDKYRKTPPFVEQPDSPAISVVATSDVKA