Protein Info for GFF1474 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Melibiose operon regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00165: HTH_AraC" amino acids 194 to 235 (42 residues), 35.2 bits, see alignment 1e-12 amino acids 248 to 285 (38 residues), 42.6 bits, see alignment 5.1e-15 PF12833: HTH_18" amino acids 208 to 285 (78 residues), 68.6 bits, see alignment E=4.7e-23

Best Hits

Swiss-Prot: 89% identical to MELR_ECOLI: Melibiose operon regulatory protein (melR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to spt:SPA4115)

Predicted SEED Role

"Melibiose operon regulatory protein" in subsystem Melibiose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF1474 Melibiose operon regulatory protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MCNGDEKQTRSPLSLYSEYQRLDVELRPPHRMASSHWHGQVEVNVPFDGDVEYLINNEVV
QIKQGHITLFWACTPHQLTRPGNCRQMAIFSLPMHLFLSWPLDRDLINHVTHGMVVKSLA
TQQLSTFEVLRWQQETSSPNEQIRQLAIDEIGLMLKRFSLSGWQPILLNKTSRTHKNSVS
RHAQFYVSQMLGFIADNYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYITAMRIN
HVRALLSDTDKTILDVALTAGFRSSSRFYSTFSKFVGMSPQQYRKLSQQRRQTMPG