Protein Info for PS417_07480 in Pseudomonas simiae WCS417

Annotation: allophanate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00724: biotin-dependent carboxylase uncharacterized domain
  • amino acids 8 to 293 (286 residues), 232 bits, E=4.4e-73
• PF02626: CT_A_B
  • amino acids 26 to 283 (258 residues), 249 bits, E=3.2e-78

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU1536)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• uracil degradation III (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

See U1V0Y5 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PS417_07480 allophanate hydrolase (Pseudomonas simiae WCS417)
MSRLIIEASTPLCLLQDGGRFGVRHLGVTQGGALDWVSMSWANWLLGNALDAPVVEITLG
GFTVQADDYCLLALAGADLGAYIDERPISPGRSFILQKGQRLRFTQPFKGARAYLAAPGG
FDAPDVLGSCATVVREELGGVDGFGKALAEGGCLAYSGTGGAMKVLSDLTLPTKAPLDVI
VGAQIGQFSGQSLFDAFNTEWALDSRADRMGMRLLGTPLQYQGPSLISEGIPLGAIQVPP
DGQPIVLLNDRQTIGGYPRLGALTPLSLARLAQCLPGEKVRLTPVVQETAHRQQLECLRQ
FI