Protein Info for GFF1470 in Sphingobium sp. HT1-2

Annotation: Cell cycle transcriptional regulator CtrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 95.4 bits, see alignment E=2.4e-31 PF00486: Trans_reg_C" amino acids 145 to 221 (77 residues), 70.4 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 79% identical to CTRA_CAUVN: Cell cycle transcriptional regulator CtrA (ctrA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K13584, two-component system, cell cycle response regulator CtrA (inferred from 96% identity to sch:Sphch_0261)

Predicted SEED Role

"DNA-binding response regulator CtrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF1470 Cell cycle transcriptional regulator CtrA (Sphingobium sp. HT1-2)
MRVLLIEDEPTTAKAIELMLTTEGFNVYTTDLGEEGLDLGKLYDYDIICLDLNLPDMHGY
DVLKKLRAARVQTPVLILSGVAEMDSKVRSFGFGADDYVTKPFHREELIARIHAVVRRSK
GHSQSVIRTGKLAVNLDAKTVEVDGNRVHLTGKEYAMLELLSLRKGTTLTKEMFLNHLYG
GMDEPELKIIDVFICKLRKKLALACGGDNYIETVWGRGYVLRDPDEVEALEARVA