Protein Info for GFF1470 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 59 to 209 (151 residues), 146.4 bits, see alignment E=6.5e-47 PF00884: Sulfatase" amino acids 238 to 527 (290 residues), 242.8 bits, see alignment E=5.3e-76

Best Hits

Swiss-Prot: 100% identical to EPTA_SALTY: Phosphoethanolamine transferase EptA (eptA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to stm:STM4293)

MetaCyc: 82% identical to phosphoethanolamine transferase EptA (Escherichia coli K-12 substr. MG1655)
RXN-14379 [EC: 2.7.8.43]

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>GFF1470 Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLKRFLKRPVLGQIAWLLLFSFYIAVCLNIAFYKQVLQDLPLNSLRNVLVFISMPVVAFS
VVNSVLTLASFIWLNRLLACVFILVGAAAQYFILTYGIIIDRSMIANMMDTTPAETFALM
TPQMVLTLGLSGVLAAVIAFWVKIRPATPRLRSGLYRLASVLISILLVILVAAFFYKDYA
SLFRNNKQLIKALSPSNSIVASWSWYSHQRLANLPLVRIGEDAHRNPLMLKGDRKNLTIL
IVGETSRGDDFSLGGYPRDTNPRLAKDDVIYFPHTTSCGTATAISVPCMFSDMPRKHYDE
ELAHHQEGLLDIIQRAGINVLWNDNDGGCKGACDRVPHQNVTELNLPGQCIDGECYDEVL
FHGLEDYIDHLKGDGVIVLHTIGSHGPTYYNRYPPQFKKFTPTCDTNEIQNCSQEQLINT
YDNTVLYVDYIVDKAINLLKSHQDKFTTSLVYLSDHGESLGENGVYLHGLPYSIAPDTQK
HVPMLIWLSKDYQQRYQVDQACLQKRASTLDYSQDNLFSTMLGLTGVQTTYYQAADDILQ
PCRRLSE