Protein Info for GFF1468 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details PF01925: TauE" amino acids 10 to 239 (230 residues), 106.1 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 65% identity to dia:Dtpsy_0039)

Predicted SEED Role

"putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF1468 putative inner membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTPETIALLVVGAAVAGFVQGLSGFAFGMVAMSFWVWGIDPRVAAVMAVFGSLTGQVVAA
VTSRRPLRLRALAPFLAGGALGIPMGIAVLPHLNPDLFRLVLGGVLVVWCPVMLLSSHLP
KISRGGRLADGVVGLAGGFMGGIGGFTGVVPTLWCTLRGMEKDAQRAIIQNFNLAALAFT
MLGYLVSGAVTRDMWPLLPLVAVALLVPVLLGSRLYVGLSEAAFRKLVLSLLSLSGLAML
VAAVPRLLAA