Protein Info for GFF1463 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 280 to 301 (22 residues), see Phobius details PF05118: Asp_Arg_Hydrox" amino acids 71 to 222 (152 residues), 169.5 bits, see alignment E=2.6e-54

Best Hits

KEGG orthology group: K12979, beta-hydroxylase [EC: 1.14.11.-] (inferred from 99% identity to sei:SPC_4349)

Predicted SEED Role

"Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO" in subsystem Lipid A modifications

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF1463 Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFAAIIIGIFIISVIYAHSRGVEKQKLSRQLFDHSTFMAPINMFMTRFSTLPAKQPYFDT
TAFPELQKLTENWQVIREEALQLQHHIKAAQANNDAGFNTFFKRGWKRFYLKWYSDAHPS
AETLCPITTKLVNSIPSIKAAMFAELPPGAYLGKHRDPYAGSVRYHLGLSTPNDDRCFIE
VDRQRHSWRDGKAVIFDETYVHWAENKTEQTRIILFCDIERPMKWRWAQSVNHWVGASLM
SAASSPNDENDRTGAINRIFKYVHAARDAGQRLKKKNRTLYYALKYLVIAAIFAAIILFS
LL