Protein Info for GFF1463 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05118: Asp_Arg_Hydrox
  • amino acids 71 to 222 (152 residues), 172.7 bits, E=2.7e-55

Best Hits

KEGG orthology group: K12979, beta-hydroxylase [EC: 1.14.11.-] (inferred from 99% identity to sei:SPC_4349)

Predicted SEED Role

"Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO" in subsystem Lipid A modifications

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Protein Sequence (302 amino acids)

>GFF1463 Fe(2+)/alpha-ketoglutarate-dependent dioxygenase LpxO (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFAAIIIGIFIISVIYAHSRGVEKQKLSRQLFDHSTFMAPINMFMTRFSTLPAKQPYFDT
TAFPELQKLTENWQVIREEALQLQHHIKAAQANNDAGFNTFFKRGWKRFYLKWYSDAHPS
AETLCPITTKLVNSIPSIKAAMFAELPPGAYLGKHRDPYAGSVRYHLGLSTPNDDRCFIE
VDRQRHSWRDGKAVIFDETYVHWAENKTEQTRIILFCDIERPMKWRWAQSVNHWVGASLM
SAASSPNDENDRTGAINRIFKYVHAARDAGQRLKKKNRTLYYALKYLVIAAIFAAIILFS
LL