Protein Info for GFF1461 in Sphingobium sp. HT1-2

Annotation: Cytidine deaminase (EC 3.5.4.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08211: dCMP_cyt_deam_2" amino acids 8 to 80 (73 residues), 38.5 bits, see alignment E=1.3e-13 PF00383: dCMP_cyt_deam_1" amino acids 10 to 112 (103 residues), 48.6 bits, see alignment E=6.5e-17

Best Hits

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 79% identity to sjp:SJA_C1-15770)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF1461 Cytidine deaminase (EC 3.5.4.5) (Sphingobium sp. HT1-2)
MSAEDKDIAALVAAARGALAHAHAPYSRFAVGAAVRLTDGSIVTGSNFENASYGLSLCAE
TVALATVNAQGRLADVAEIAVVGGGMAADGSVGGEAIVSPCGRCRQVINEAEQMAGRTLA
IYCVAPEGDGLVEHRIADLLPHAFGPADLGITPAQKS