Protein Info for GFF1460 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 285 to 334 (50 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 270 (248 residues), 41.2 bits, see alignment E=5.1e-15

Best Hits

KEGG orthology group: None (inferred from 60% identity to mex:Mext_1916)

Predicted SEED Role

"Major facilitator superfamily (MFS) transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>GFF1460 hypothetical protein (Xanthobacter sp. DMC5)
VSAAASPAGTGGAGRSVIAALGVVQILTWGSSFYLLTVLAGPISRDTGWPLQWIVGSLSV
GLLVAGLVSPKVGALIDARGGRPVLAGGCALLACGLALLALAQGPAMFMLGWCIAGAGMA
ASLYDAAFAALGRLYGAGARRAITMLTLWGGFASTVCWPITAFLDAHMGWRATCLVYAGL
HLFVSIPLVLAFMPAIAPRVETGRPARGGPVVLGGPERISFLLMAGIVTLIGTIASAMSV
QVLALLQSRGLSLAEAVAAGAFIGPSQVFARIIEQASGGRHHPLWTMIWAVALMGLGLVM
LAAGFPIVAVALVAYGAGNGIFSIAKGTVPLAVLGAERYPVLAGRLARPALLAQALAPLG
AAQLLAAWGAGAAFSALICLWLAAAVLLALLWRRV