Protein Info for GFF1456 in Sphingobium sp. HT1-2

Annotation: Glutaryl-7-ACA acylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00976: hydrolase CocE/NonD family protein" amino acids 53 to 629 (577 residues), 230.8 bits, see alignment E=2.1e-72 PF02129: Peptidase_S15" amino acids 56 to 340 (285 residues), 197.4 bits, see alignment E=5.5e-62 PF00326: Peptidase_S9" amino acids 109 to 207 (99 residues), 23.2 bits, see alignment E=6.6e-09 PF08530: PepX_C" amino acids 392 to 603 (212 residues), 89.9 bits, see alignment E=3.5e-29

Best Hits

KEGG orthology group: K06978, (no description) (inferred from 59% identity to xoo:XOO2664)

Predicted SEED Role

"Glutaryl-7-ACA acylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>GFF1456 Glutaryl-7-ACA acylase (Sphingobium sp. HT1-2)
MLRAAQISTAALMIAALAAPIAAQTDPMTPDKVDVYDPARPQADYVRKEVMIPMRDGVKL
FTVIVMRKGTSHGPILLTRTPYDAGKATSRNRSQKIEEILPVMDADFVNDGYIRVYQDVR
GLHGSEGDYVMTRPLRGPLNKTDVDNSTDAYDTIDWLVKNVPETNGKVAITGSSYPGFTS
LMALIDPHPALKAAVPQSPMVDGWMGDDWFHNGAFRNFGFGYSLSQTAKKGGGAIPMGNG
DEYTTMLNAGSAGDFARTYGLDAFPSVRKLLEHPAYDAYWQEQAVDKLLAKRTLTVPTML
VVGQWDQEDSYGAPAVYKALEPQDKKNDMVSLVIGPWRHSGVNYEGRSLGDLQFEGDTGR
QFRVGTMKPFLDHYLKDNPPAGYTMPGSLSYATGIDKWETRAKWPGGTPTPLYLGASYSL
SWAKPAAAGSDSYVSDPAKPVPYLPRPIHQDQNEAWRTWLVKDQRFVDGRPDVLTYVTPV
LDKDVHIAGQPMVDLFAATSGTDSDWVVKLIDVYPEENTANPVMAGYELPIGIDIFRGRY
AHGFDKPQALTPGKAENYKFGLPNVNHVFKPGHRIMVQIQSSLFPVYDRNPQTYVPSIFD
AKPGDYKPATQSVQYGAAGASAIWLPIVK