Protein Info for GFF1454 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cytochrome c-type protein NrfB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03146: cytochrome c nitrite reductase, pentaheme subunit" amino acids 38 to 171 (134 residues), 192.7 bits, see alignment E=3.9e-61 PF22678: Cytochrom_c_NrfB-like" amino acids 78 to 166 (89 residues), 137.4 bits, see alignment E=4.4e-44 PF13435: Cytochrome_C554" amino acids 107 to 143 (37 residues), 15.5 bits, see alignment 7e-06

Best Hits

Swiss-Prot: 89% identical to NRFB_ECOL6: Cytochrome c-type protein NrfB (nrfB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04013, formate-dependent nitrite reductase, penta-haeme cytochrome c (inferred from 100% identity to sty:STY4476)

MetaCyc: 89% identical to periplasmic nitrite reductase penta-heme c-type cytochrome (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cytochrome c-type protein NrfB precursor" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>GFF1454 Cytochrome c-type protein NrfB precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSVLRSLLTAGVLASGLFWSLSGITATPTPQESDQRWTVTQQRNPDAACLDCHKPDTEGM
HGKHTGAINPNNKLPITCTNCHGQPSLHHREGVKDVMRFNDPMYTVEQQNSVCMSCHLPE
QLQKAFWPHDVHVTKVTCASCHSLHPQQDTMQTLSEKGRIKICVDCHSDQRTNPHFNPAS
VPLLKEQP