Protein Info for GFF1450 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 987 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 300 to 426 (127 residues), 59.4 bits, see alignment E=3.9e-20 amino acids 432 to 546 (115 residues), 56.3 bits, see alignment E=3.5e-19 PF13188: PAS_8" amino acids 302 to 355 (54 residues), 28.1 bits, see alignment 4.9e-10 amino acids 431 to 478 (48 residues), 27.3 bits, see alignment 8.9e-10 PF00989: PAS" amino acids 302 to 354 (53 residues), 32.8 bits, see alignment 2.1e-11 amino acids 431 to 539 (109 residues), 44.9 bits, see alignment E=3.7e-15 PF08448: PAS_4" amino acids 308 to 421 (114 residues), 33.9 bits, see alignment E=1.1e-11 amino acids 434 to 543 (110 residues), 24.4 bits, see alignment E=1e-08 PF13426: PAS_9" amino acids 314 to 403 (90 residues), 21.7 bits, see alignment E=7e-08 amino acids 439 to 541 (103 residues), 46.6 bits, see alignment E=1.2e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 551 to 705 (155 residues), 106.7 bits, see alignment E=1.1e-34 PF00990: GGDEF" amino acids 554 to 704 (151 residues), 120 bits, see alignment E=3e-38 PF00563: EAL" amino acids 729 to 963 (235 residues), 235.1 bits, see alignment E=2.6e-73

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (987 amino acids)

>GFF1450 hypothetical protein (Xanthobacter sp. DMC5)
MKRRSYIASVTIAYAVGALLWIYLSDRFIESVGGSIGFGVFSTLKGFVFVAVTTALLYFA
LHTAAQGKEAARPILMFRGWVLFAVLTLLTLPAGLISYAVFRSASDTLLGERRGQLEFMT
EAVARSIDAEVARRTLGATPQEPQAPPSILLAIVTNGSAGFSRLQDFAGLMGDSARVLIA
SKTGSDGRWMIAGAQQALPEALVPLAADGADGLAADIVSPPGGEPLLAAAAMIPAANAVL
VATVATADVVDDVRGVAFLSAMTAAACLLVAGVLTLLFIQRQRLRVALAEADQKAALHAA
EERFRATFEQAAEGIAHLDLDGRFLRVNETLCALLGYGRAELLGRSYADVRPNIRAGAGG
TSREAVASLPSGTVVEARGDQPHLTRAGEEIWLSCVQSIARDTPEDADYIILMVSDATAR
RTAEHHLTLAQAVFTNTQEGLVVTDLAGRITAVNPAFVAITGHQEAEILGQNMRFLSSGR
HDRLFYQLLWTALKDTGVWRGEIWNRRKDGTLYLQQTVISTVYGRTGAAESYVGAFNDIT
QARKSEIEVDRLTRYDPLTGLPNRTLTYSLIEHELTREGTRCAVLYIDIDHLKTINDSLG
FAAGDTVLRAAAQRIRRTAPEDATIGRYGADEFVVVIDAGEGPQAVVSLAVRLIEALGEP
FAAEGVSDLFVNASIGISLFPEDASDADTLLQHAHSALFEAKSRDGRTYAFYTDALTRDA
RARIQLVANLRRALTEHEFTVHYQPIVRLEDQTIVGAEALVRWVTPEGEMIGPDRFIPVA
EETGLIVPLGDFVLAAACTQMARWRKAGLPCAFVAVNISAGQLNATDICAKTEAALAASG
VPADSIEFEITESMLFGADSGAESKLKRITELGVRIAIDDFGTGYSSLAYLKRFPISRLK
IDKSFVDDLPLSVVDGELVRAMIEMGRALHIEVLAEGVEEAGQMAFLAANGCTYGQGFFW
SRPLPPERFEALFSNASPIPWARAGTA