Protein Info for GFF1449 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF02049: FliE" amino acids 25 to 104 (80 residues), 89.3 bits, see alignment E=7.7e-30 TIGR00205: flagellar hook-basal body complex protein FliE" amino acids 33 to 103 (71 residues), 69.7 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 43% identical to FLIE_CUPNJ: Flagellar hook-basal body complex protein FliE (fliE) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 66% identity to aaa:Acav_4293)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>GFF1449 Flagellar hook-basal body complex protein FliE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDMRISPLSSQALNGIGSTALKRPGAAGGVEGGFAANFKSALKEVSASQEAASKLQTQVQ
LGNPKVSLEETMLAMQKAQVGFQATLHVRNRMVQAYSDIMNMSV