Protein Info for GFF1436 in Xanthobacter sp. DMC5

Annotation: NAD(P)H-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF03358: FMN_red" amino acids 9 to 154 (146 residues), 155.6 bits, see alignment E=7.3e-50 PF02525: Flavodoxin_2" amino acids 18 to 102 (85 residues), 34.5 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 64% identical to FMNRE_PSEAE: NAD(P)H-dependent FMN reductase PA1204 (PA1204) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 65% identity to azo:azo2988)

MetaCyc: 48% identical to quinone reductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]; RXN0-3381 [EC: 1.6.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF1436 NAD(P)H-dependent FMN reductase (Xanthobacter sp. DMC5)
MASDARPIRVVGISGSLRKGSYNTMALKAAMELAPEGMTIEAAEIGDLPHYNDDVRLAGY
PPEVERFRAQLTAADAILFVTPEYNYSIPGVLKNAIDWASRPPSQPFDNKPVAIMGASMG
VLGTARAQYQLRQMLVFLNAFPLNKPEVMIGAAQTKFDASGALTDEATADFIRQLLTALA
AWTERLR