Protein Info for GFF1431 in Xanthobacter sp. DMC5

Annotation: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00561: Abhydrolase_1" amino acids 24 to 121 (98 residues), 46.4 bits, see alignment E=4.2e-16 PF12697: Abhydrolase_6" amino acids 29 to 266 (238 residues), 55.8 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 60% identity to pde:Pden_1652)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF1431 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase (Xanthobacter sp. DMC5)
MKRDTFHAQDGASLAFSDVGTGRPLLALAGFTRNGRDFDYLGRHLHDVRLIRLDSRGRGE
SQWTGADTYTALQESDDALALLDHLGIPRVAIIGSSRGGILAMLMAMKAPARVAGVCLND
VGPVMERAGLERIGAYIGVEPAVTTLEEIADRMPQANPGFHHVPELRWEEEAIRRFVQTP
NGVGLPYDPDLRLSFQKALAAPATDAWPLFDACAGVPLALIRGANSDVLSAGAAAAMAAR
RPDMIYADVPDRGHTPFLDEPEALAAIHQWIDRCSFAEEETPSRDAVGGDAAQQQRAG