Protein Info for GFF143 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 TIGR00002: ribosomal protein bS16" amino acids 3 to 82 (80 residues), 108.1 bits, see alignment E=8.7e-36 PF00886: Ribosomal_S16" amino acids 9 to 70 (62 residues), 96.9 bits, see alignment E=2.6e-32

Best Hits

Swiss-Prot: 87% identical to RS16_AZOC5: 30S ribosomal protein S16 (rpsP) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 87% identity to azc:AZC_3952)

Predicted SEED Role

"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>GFF143 hypothetical protein (Xanthobacter sp. DMC5)
MSLKIRLARGGAKKRPYYRIVVADARAPRDGRFIEKIGTFNPLLAKDSETRVVLDTEKAK
AWLEKGAQPTDRVARFLDAAGLLKRETRNNPKKAEPGQKAQERAKEKADKAAAAAGGEAA
E