Protein Info for GFF1428 in Xanthobacter sp. DMC5

Annotation: Acetate CoA-transferase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01144: CoA_trans
  • amino acids 8 to 212 (205 residues), 205.1 bits, E=4.8e-65
• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 8 to 214 (207 residues), 222.5 bits, E=2.2e-70

Best Hits

Swiss-Prot: 50% identical to ATOD_ECOLI: Acetate CoA-transferase subunit alpha (atoD) from Escherichia coli (strain K12)

KEGG orthology group: K01034, acetate CoA-transferase alpha subunit [EC: 2.8.3.8] (inferred from 62% identity to msl:Msil_1855)

MetaCyc: 50% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

MetaCyc Pathways

• acetyl-CoA fermentation to butanoate (6/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• L-glutamate degradation XI (reductive Stickland reaction) (3/7 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• 4-aminobutanoate degradation V (2/7 steps found)
• succinate fermentation to butanoate (2/7 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism
• Propanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.8

Use Curated BLAST to search for 2.8.3.8

Protein Sequence (217 amino acids)

>GFF1428 Acetate CoA-transferase subunit alpha (Xanthobacter sp. DMC5)
MRKAIRPEEAADIVPDGAVVLIGGFMGVGTPERMIDALVARGVKNLTVVANDAAMPGKGI
GKLVSAGAVSRAIMSHIGLNPEIQQKMIAGEIEVELVPQGTLVERIRAAGVGLGAVVTAT
GIGTPVEEGKQVLEIDGKRYLVEKPIHGDYALIAAQQADYAGNLLYSLTAHNFNPIMALA
GRTVIVEPEMIVPIGVIPPDAVKTPGVLVDHMLARAA