Protein Info for GFF1426 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details PF00672: HAMP" amino acids 313 to 360 (48 residues), 27.9 bits, see alignment 3.7e-10 PF26769: HAMP_PhoQ" amino acids 317 to 359 (43 residues), 33.1 bits, see alignment 6.7e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 374 to 540 (167 residues), 150 bits, see alignment E=2.6e-48 PF00990: GGDEF" amino acids 378 to 537 (160 residues), 145.1 bits, see alignment E=2.5e-46

Best Hits

KEGG orthology group: None (inferred from 71% identity to xau:Xaut_0279)

Predicted SEED Role

"diguanylate cyclase with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>GFF1426 hypothetical protein (Xanthobacter sp. DMC5)
MVERNGGDGAAAPGRRSSLRLRVLFLVCLVAVPLSVERMLALVAERQEQVSALEEDVRNF
ARSAKLAQMEGISRSLTALDVLSRMADRLLEDPAACNRQLSRLADEVAGIQGAFIADAAG
LVRCAHAPLALGVNISERDYFRDAAATDGVVMTEMFVSRVSGRNSVFLLRAEHGPGGAVR
AVAAVVVDLQWLSRIAAGTAVELGVVVDLIGENGTVLVRYPTMPEIVEHRFPDHPLTRAV
AAEESGIVRVPGYDGKERIFAFEGFGHLPISIAVGIETAKAVGPIDSKVRSTALAYFIAL
ACFLLLAWVAEERIVIAPIARLTRAVAAVGRGEADHVNDMGVAEFSPLVNAFNEMARRLS
QRNNELRTMNGRLASLARTDGLTGLANRRTFDVQFSQDWVRARGEGVPLTLVMLDVDHFK
AFNDTRGHLQGDEALRAVARMLSAAAAGTSNLVARYGGEEFVVLMSGADVGAGVAFAEDV
RRLLAEIALDHPAAPRRRVTASFGVASVVPTAEGSPDALIAAADAALYEAKRAGRDRVIA
HR