Protein Info for PS417_07245 in Pseudomonas simiae WCS417

Updated annotation (from data): 2-deoxy-D-ribonate 3-dehydrogenase
Rationale: Specifically important in carbon source 2-Deoxy-D-Ribose; also important for deoxyribonate utilization, so this is the second dehydrogenase in the pathway
Original annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF00106: adh_short" amino acids 15 to 198 (184 residues), 156.9 bits, see alignment E=9e-50 PF08659: KR" amino acids 15 to 172 (158 residues), 27.7 bits, see alignment E=4.8e-10 PF01370: Epimerase" amino acids 15 to 247 (233 residues), 25.5 bits, see alignment E=1.7e-09 PF13561: adh_short_C2" amino acids 20 to 257 (238 residues), 182.2 bits, see alignment E=2.6e-57

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU1491)

MetaCyc: 100% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"SHORT CHAIN DEHYDROGENASE"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEI0 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PS417_07245 2-deoxy-D-ribonate 3-dehydrogenase (Pseudomonas simiae WCS417)
MSVLQRLQPYPGLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGTV
ATRADVSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTA
QYRFAHHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESD
IRVNALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFL
CSPAARNVTGQAISVDGNVEYL