Protein Info for GFF1423 in Variovorax sp. SCN45

Annotation: Phenylacetate ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 216 to 216 (1 residues), see Phobius details amino acids 225 to 257 (33 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 274 (267 residues), 137.5 bits, see alignment E=2.5e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 58% identity to dar:Daro_0367)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF1423 Phenylacetate ABC transporter, permease protein 1 (Variovorax sp. SCN45)
MSDLAQFVLSGLTTGAVYALAALGFTLIYNASGVINFAQGDFLMLSAMVAATLVTRQVPY
PVAIALGLLATVVVGLMLYRFAIRPAGDADVVTLIIITIGASIFIQGVVQVVLGKNQQVL
APFSGDTPLNVLGARVLPQAMWVLGVGALMVAAVAAFFRYTLIGKATLAVAANKLAASAV
GIPTRRVLQLSFGLSALLGSVAGVVAAPITTTVYDIGLMLGMKGFVAATLGGLGSGLGAV
VGGLIVGVLEALVAGYISSAYKDAVPFVMIIVILLVMPQGLFGRKSTERV