Protein Info for GFF1423 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to TYRB_SALTY: Aromatic-amino-acid aminotransferase (tyrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00832, aromatic-amino-acid transaminase [EC: 2.6.1.57] (inferred from 100% identity to stm:STM4248)

MetaCyc: 88% identical to tyrosine aminotransferase (Escherichia coli K-12 substr. MG1655)
Branched-chain-amino-acid transaminase. [EC: 2.6.1.42, 2.6.1.6]; Aromatic-amino-acid transaminase. [EC: 2.6.1.42, 2.6.1.6, 2.6.1.57]; Aspartate transaminase. [EC: 2.6.1.42, 2.6.1.6, 2.6.1.57, 2.6.1.1, 2.6.1.27, 2.6.1.5]; 2.6.1.1,2.6.1.57,2.6.1.27 [EC: 2.6.1.42, 2.6.1.6, 2.6.1.57, 2.6.1.1, 2.6.1.27, 2.6.1.5]

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

superpathway of chorismate metabolism (54/59 steps found)
aspartate superpathway (24/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-threonine metabolism (17/18 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (10/10 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-leucine biosynthesis (6/6 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
L-valine biosynthesis (4/4 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
TCA cycle VIII (Chlamydia) (5/6 steps found)
L-alanine biosynthesis I (2/2 steps found)
L-glutamate degradation II (2/2 steps found)
L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
malate/L-aspartate shuttle pathway (2/2 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-aspartate biosynthesis (1/1 steps found)
L-aspartate degradation I (1/1 steps found)
L-tyrosine biosynthesis III (3/4 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
L-asparagine degradation III (mammalian) (2/3 steps found)
L-isoleucine biosynthesis V (2/3 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-phenylalanine degradation II (anaerobic) (2/3 steps found)
L-valine degradation II (2/3 steps found)
indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
L-isoleucine biosynthesis IV (4/6 steps found)
L-isoleucine degradation I (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
L-tyrosine degradation I (3/5 steps found)
L-isoleucine biosynthesis II (5/8 steps found)
L-valine degradation I (5/8 steps found)
L-phenylalanine biosynthesis II (2/4 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
L-tyrosine biosynthesis II (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
(R)-cysteate degradation (1/3 steps found)
L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
sulfolactate degradation III (1/3 steps found)
L-leucine degradation I (3/6 steps found)
superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
superpathway of sulfolactate degradation (2/6 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
superpathway of plastoquinol biosynthesis (1/5 steps found)
coenzyme M biosynthesis II (1/6 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
indole-3-acetate biosynthesis II (3/12 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
tropane alkaloids biosynthesis (1/11 steps found)
superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1, 2.6.1.42

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.27 or 2.6.1.42 or 2.6.1.5 or 2.6.1.57 or 2.6.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>GFF1423 Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VFQKVDAYAGDPILSLMERFKDDSRHDKVNLSIGLYYNEDGIIPQLKTVAEAEARLNAQP
HGASLYLPMEGLNTYRHTIAPLLFGADHPVLQQQRVATIQTLGGSGALKVGADFLKRYFP
DAGVWVSDPTWENHIAIFAGAGFEVSTYPWYDDATNGIRFNDLLATLNTLPARSIVLLHP
CCHNPTGADLTPSQWDAVIEIVKARDLIPFLDIAYQGFGAGMDDDAYVIRAIASAGLPAL
VSNSFSKIFSLYGERVGGLSVVCEDAEIAARVLGQLKATVRRIYSSPPCFGAQVVATVLG
DEALKAGWLAEVDAMRNRIISMRQTLVKELKAEMPDRNFDYLLQQRGMFSYTGLSEEQVD
RLRDEFGVYLIASGRMCVAGLNASNVHRVAKAFAAVM