Protein Info for GFF1420 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Quinone oxidoreductase (EC 1.6.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF08240: ADH_N" amino acids 29 to 88 (60 residues), 37.3 bits, see alignment E=3.3e-13 PF00107: ADH_zinc_N" amino acids 152 to 281 (130 residues), 100.5 bits, see alignment E=1.1e-32 PF13602: ADH_zinc_N_2" amino acids 185 to 321 (137 residues), 66.6 bits, see alignment E=6.9e-22

Best Hits

Swiss-Prot: 100% identical to QOR_SALTY: Quinone oxidoreductase (qor) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 99% identity to sec:SC4124)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF1420 Quinone oxidoreductase (EC 1.6.5.5) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MATRIEFHKHGGPEVLQTVEFTPAEPAEHEIQVENKAIGINFIDTYIRSGLYPPPSLPAG
LGTEAAGVVSKVGNGVEHIRVGDRVVYAQSTLGAYSSVHNVTADKAAILPDAISFEQAAA
SFLKGLTVFYLLRKTYEVKPDEPFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQKAQR
ALDAGAWQVINYREESIVERVKEITGGKKVRVVYDSVGKDTWEASLDCLQRRGLMVSFGN
ASGPVTGVNLGILNQKGSLYATRPSLQGYITTREELTEASNELFSLIASGVIKVDVAENQ
RYALKDARRAHEVLESRATQGSSLLIP