Protein Info for GFF1418 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: tRNA dihydrouridine synthase A (EC 1.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR00742: tRNA dihydrouridine synthase A" amino acids 14 to 329 (316 residues), 565.2 bits, see alignment E=2.3e-174 PF01207: Dus" amino acids 17 to 325 (309 residues), 330.5 bits, see alignment E=4.9e-103

Best Hits

Swiss-Prot: 100% identical to DUSA_SALTY: tRNA-dihydrouridine(20/20a) synthase (dusA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 99% identity to sec:SC4122)

MetaCyc: 91% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF1418 tRNA dihydrouridine synthase A (EC 1.-.-.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQPETQSSALPAYRFSIAPMLDWTDRHCRYFLRLLSRQTQLYTEMVTTGAIIHGKGDYLA
YSEEEHPVALQLGGSDPAQLAHCAKLAEARGYDEINLNVGCPSDRVQNGMFGACLMGNAQ
LVADCVKAMRDVVSIPVTVKTRIGIDDQDSYAFLCDFIDTVSGQGECEMFIIHARKAWLS
GLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKEHLRHMDGVMVGREAYQ
NPGILAAVDREIFGADTTDADPVAVVRAMYPYIERELSQGAYLGHITRHMLGLFQGIPGA
RQWRRYLSENAHKAGADVAVLEQALKLVADKR