Protein Info for GFF1415 in Sphingobium sp. HT1-2

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 233 (18 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 357 to 383 (27 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details TIGR00831: Na+/H+ antiporter" amino acids 7 to 542 (536 residues), 426.2 bits, see alignment E=8.5e-132 PF00999: Na_H_Exchanger" amino acids 14 to 420 (407 residues), 217.5 bits, see alignment E=1.3e-68

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 67% identity to swi:Swit_5394)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>GFF1415 Na+/H+ antiporter (Sphingobium sp. HT1-2)
LDVISVVLFLLLAVVVSGALSRMMPISIPTPLVQIALGAIIGLSTSHRVALDPEIFLLLF
LPPLLFLDGWRIPKDELLKDASTVVELALGLVLTTVIGMGFFINWMIPAMPLAVAFALAA
VVSPTDPIAVSAIAARVPIPKRMMHILEGESLLNDASGLVCLRFAIAAALTGSFSAGDAA
LNFLWLAFAGIAIGVGVTLVVSRAKAWVTRRWGEETGSQILVSLLIPFGSYILAEHVHAS
GILAAVAAGVTMTFAEISREAMAETRMRRNSVWDTIQFTLNGIIFVLLGEQLPGILAEAK
RTVALTGHSEPGWLALYTVAIVVGLAALRFLWVWLSLRFTILRNQYRGVDGPRRPNWRLV
AATSFAGVRGAITLAGVLTLPLALNDGTPFPARDLAIFLAAGVIILSLILASVALPLLLK
NLDMPAEASKAAEEDAARIVTAEAAIQAIERHQHDLAETHGHAERYAEAGARVMDLYRER
IEALGAAEADSLRAQGALFRDFRMVGVAAERTALLTLLRSRKIGSEVGRKLTRELDLSEA
RLRT