Protein Info for GFF1410 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 67 to 128 (62 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 211 to 226 (16 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details PF13515: FUSC_2" amino acids 197 to 317 (121 residues), 47.6 bits, see alignment E=9e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF1410 hypothetical protein (Xanthobacter sp. DMC5)
MSGPGERLRVWLAQELHLGAIARALAVIGPLVIAYLVSGEPALVNLCLLTVSLLIPVLKL
RLSPAAVIVQYLVIVATFLVLFLAVSIPPLFVVLAALTGFMAAAVTRFGTLMRTLGNWVF
IPSVYLALDIREGALGEAALWQAGVLLGLSPVGLVLVCAVQALDGRRRTLDRSEIFGPPS
GDWLVPAVATAAAVFAAAVLVEMFDIREGQWLIWSAASVVVGDLSASTGKLKLRALGALV
GAPLGLLIGLALPVSEAGYSFCVLGAMLTLIAFSRYVVGFGARCFFIALAAAFAGTGSGI
AAERVENVLIGGAFGLVAVALAEIARPPRRMRPERPASP