Protein Info for GFF1407 in Xanthobacter sp. DMC5

Annotation: Multidrug resistance protein MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 370 (326 residues), 266.2 bits, see alignment E=1.7e-83 PF16576: HlyD_D23" amino acids 64 to 289 (226 residues), 49.1 bits, see alignment E=6.7e-17 PF13533: Biotin_lipoyl_2" amino acids 68 to 113 (46 residues), 49 bits, see alignment 6.2e-17

Best Hits

Swiss-Prot: 46% identical to MDTA_CROTZ: Multidrug resistance protein MdtA (mdtA) from Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 69% identity to xau:Xaut_1596)

MetaCyc: 44% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF1407 Multidrug resistance protein MdtA (Xanthobacter sp. DMC5)
MRVFPFVISSIVVVAGALAWQQGLIGAAAQASKPKAPPPPIPVIATAVKTEDVPVYGEGI
GTVQASNTITVKVRVDGELTKVVFKEGQEVKAGDILAQIDQRPFAAALAQAKAARAKDEA
LLANAKADYDRYKVLVPKQAASQQQLDTQSALVAQYQAQISGDEAAIDNAQIQLDYTTIR
APISGRTGVRLVDEGNIVHANDGGGLVVITQLKPVAVVFTLPQDRLDDMQAALARGPVSA
LAFRRDGVTEVGEGTVALIDNQISSDTGTLRIKAVFPNDDLKLWPGAFVNVKVLLDTHHN
VITIPAQAIQRGPDGFYVYVVKPDATVEKRAVTTSGISAGIASIATGLVAGDQVVIDGQY
KLIPGARVTVRPPPATPPARSVMVGAPA