Protein Info for PS417_07150 in Pseudomonas simiae WCS417

Annotation: permase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 20 to 51 (32 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 240 to 269 (30 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 307 to 335 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 21 to 345 (325 residues), 228.4 bits, see alignment E=6.6e-72

Best Hits

KEGG orthology group: K03548, putative permease (inferred from 99% identity to pfs:PFLU1474)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3H0 at UniProt or InterPro

Protein Sequence (356 amino acids)

>PS417_07150 permase (Pseudomonas simiae WCS417)
MFKVLRDWIQRYFSDEEAVVLAVLLFLAFTAVLTLGGMLAPVLAGMVLAYLMQGLVTTLE
RLRLPGGAAVGLVFALFMGLLVLFIVVVLPLLWHQLITLFNELPGMLAKWQSLLLLLPER
YPHLVSDEQVLQAIEAARGEIGKFGQWALTFSLSSLPLLVNIMIYLVLVPILVFFFLKDR
VMIGRWVRGYLPRERALITRVAEEMNRQIANYIRGKVIEIIICGGVTYIAFIALDLNYAA
LLALLVGISVVVPYVGAVVVTVPVALIALFQWGWSDQFIYLMAVYGIIQTLDGNVLVPLL
FSEAVNLHPVAIICAVLLFGGLWGFWGVFFAIPLATLFKAVLDAWPRQEPVVAPLL