Protein Info for PS417_07130 in Pseudomonas simiae WCS417

Annotation: RNA polymerase sigma-H factor AlgU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03888: MucB_RseB" amino acids 23 to 193 (171 residues), 173.9 bits, see alignment E=2.6e-55 PF17188: MucB_RseB_C" amino acids 212 to 311 (100 residues), 93.8 bits, see alignment E=6e-31

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 92% identity to pfs:PFLU1469)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0Y2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PS417_07130 RNA polymerase sigma-H factor AlgU (Pseudomonas simiae WCS417)
MRAIPLLTLLLSGCFALPAHADEAQDWLTRLGRAEQQQSFQGTFVYERNGSFSTHDIWHR
VQEGQVRERLLQLDGSAQEVVRLDGRTQCVSGTLVAGLGNSRDAPSRALDPQKLKQFYEL
AVIGKSRVAGRNAVIVSITPRDQYRYGFELHLDRETALPLKSLLLNDQGQLLERFQFTRL
NTSVVPDDRDLQPSSECAPLSVANEKAPVVQPTEAWHLEWLPPGFQLTSTSSRKDTQTKA
TVDSLMYEDGLARFSVFLEPISDASVTETRTQLGPTVAVSRRLNTVDGEMMVTVVGEIPI
GTAERIALSVRGEKKPAVQP