Protein Info for GFF1402 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Queuosine Biosynthesis QueC ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00364: queuosine biosynthesis protein QueC" amino acids 19 to 243 (225 residues), 192 bits, see alignment E=4.4e-61 PF06508: QueC" amino acids 19 to 250 (232 residues), 222.7 bits, see alignment E=2e-70

Best Hits

Swiss-Prot: 78% identical to QUEC_POLSJ: 7-cyano-7-deazaguanine synthase (queC) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 78% identity to pol:Bpro_0734)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF1402 Queuosine Biosynthesis QueC ATPase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEAIMTSAPPASTPHHTSALVLFSGGQDSTTCLAHALSRYPRVETIGFDYGQRHSVEMTA
RLNVLRELRQRFPAWSQRLGEDHVLDLGVLGKVSETSLTRDMAFRMEENGLPNTFVPGRN
LLFLTLAAALAYRRGIQVIVTGVCETDFSGYPDCRDDTMKALQVALSLGMDHRFLIDTPL
MWIDKAATWRLAHELGENALLVGGGNALVNLIVEHTHTCYLGDREHRQPWGYGCGGCPAC
ELRAKGWANYAAPVA