Protein Info for GFF1401 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PsiE protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details PF06146: PsiE" amino acids 19 to 130 (112 residues), 83.2 bits, see alignment E=8.6e-28

Best Hits

Swiss-Prot: 100% identical to PSIE_SALTI: Protein PsiE (psiE) from Salmonella typhi

KEGG orthology group: K13256, protein PsiE (inferred from 98% identity to seg:SG4068)

Predicted SEED Role

"PsiE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>GFF1401 PsiE protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEG
LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL
LVITLWLCNSNRLRRE