Protein Info for GFF1400 in Xanthobacter sp. DMC5

Annotation: ATP-binding/permease protein CydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 87 to 113 (27 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 266 to 292 (27 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 42 to 570 (529 residues), 623.9 bits, see alignment E=1.5e-191 PF00664: ABC_membrane" amino acids 49 to 299 (251 residues), 101.7 bits, see alignment E=6.1e-33 PF00005: ABC_tran" amino acids 379 to 528 (150 residues), 101.4 bits, see alignment E=6.5e-33

Best Hits

KEGG orthology group: None (inferred from 49% identity to amv:ACMV_16810)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>GFF1400 ATP-binding/permease protein CydD (Xanthobacter sp. DMC5)
VWYLPLPLGGACRLPCKRGEGRIATDRKRLSAFLSGFRGTARADLGRSLAASAATGLLVI
AQAFLVARIIDAVLFRHETLSSHGLELAVLVGAILLRVGAVWASEHFGFAAAAKVMRALR
SRLLDRVEAIGPVGLAEARTGELVAALAEGVRAVEPYYSRYIPASVLAVMLPVAVLVAAF
PFDWVSGLILLATAPFIPVFMILIGKGTEALNQKQWRRLARMSGHLLDAVQGLATLKAFN
AAGRMVTEVATVADDYRRDTMAVLRVAFLSSAVLEFFATVSIALIAIFIGFRLLWGEMLF
FPGLFVLLLAPEFYAPLRAMGTAYHARMEAIGAAERLVALEEMPALAESGGATPLPGPEA
ISIRFEDVRLAFPDGRVALDGVSFTVHSGETVALVGPSGAGKSSILSLALGFVRPTSGRV
LVNGVPLAELDLADVRRRIAYVPQRPRLFAGTLATNIAPGEATPDPARLVRAVADAGLAD
VVAALPGGLASDVGEGGAGLSGGQAHRLAVARAFYRAAPLVVLDEPTAHLDRESEADVQA
ALSRLLASRTGLVAAHRLASVAGADRILVLAAGRIVTEGTPAHLLRHGGLDGDLVPDLAP
TVSEAEAAG