Protein Info for GFF140 in Sphingobium sp. HT1-2

Annotation: Alanine racemase (EC 5.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00492: alanine racemase" amino acids 12 to 345 (334 residues), 193.4 bits, see alignment E=2.9e-61 PF01168: Ala_racemase_N" amino acids 13 to 215 (203 residues), 150.7 bits, see alignment E=5.4e-48 PF00842: Ala_racemase_C" amino acids 226 to 345 (120 residues), 104.6 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 43% identical to ALR_ACICJ: Alanine racemase (alr) from Acidiphilium cryptum (strain JF-5)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 71% identity to sch:Sphch_0757)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF140 Alanine racemase (EC 5.1.1.1) (Sphingobium sp. HT1-2)
MTGYIAPLRLRLDGDALLSNWRWLARQGGAPACGAAIKADGYGLGAAGVMQRLKSAGCRD
FFVSNWGEAAALEAQMDGVNFAVLHGVRNEDMAQALASRARPVLCTPGQVARWKAAGGGA
CDLMIDTGMNRLGLDWRADLSELVSGLEIVTLLSHLASADEDSDLNPTQLARFRDVLAAV
PAQRYSLANSAGICMGADYGFDLTRPGIALYGGVPHPDAAPDLRPVVQPQAQILQRRAVI
AGDTIGYNATHRAERDLEIAILNIGYADGYLRGFSGRGAALVDGIRLPVLGRVSMDLLAV
DVGARPDVAEGDWLTIDYDLPQAAHASGLSQYELLTGLGKRFDRIWA