Protein Info for GFF1399 in Xanthobacter sp. DMC5

Annotation: putative ABC transporter ATP-binding/permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 6 to 533 (528 residues), 415.2 bits, see alignment E=2e-128 PF00664: ABC_membrane" amino acids 27 to 291 (265 residues), 37.8 bits, see alignment E=1.8e-13 PF00005: ABC_tran" amino acids 355 to 503 (149 residues), 96.5 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 61% identity to xau:Xaut_2459)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>GFF1399 putative ABC transporter ATP-binding/permease protein (Xanthobacter sp. DMC5)
MKDALRLLRLMAPHAGWMGLAVLVSALATLAHIALMATSGWFIAAMALAGAAGASVNYFT
PSAAIRAYAVVRTVGRYGERIVGHEATLKFVAELRPWFFARLIPLAPAALEDQRSGDLLA
RLKGDIDRLEFAFLRILSPGLAAVLVLAVGLTVLALHDGGMAVGIGLAALLAGLGLPLLV
HRLGARVAREVTAGTAQLNALLVDHLEGRAELDIYDPDRRHRAALDETSDTLIAREHRLA
GILGFAGAGVGLFAQSSLVLVLLIGAPRVLAGTLPGADLPMLALLALSLFEAVAPLPLAF
QTLPATLASARRIFDLLDRPPPVEEPAAPKPVPETGTLAFAHAGLTYPGASGPALTDIDL
ALAPGRRIGVVGSSGSGKSSLVALALRFRAPAPGEVTFAGSSIADFNSDDLRRRMAVLAQ
HDHLFAATIRENLLVADPDASPEKLEAALERAGVLAFVAAQPEGLDTFLGANGAKVSGGQ
ARRLGLARALLKEAPLLILDEPTEGLDGETERDVLEGVLGVARDQALLFITHRRAGLEAM
DEIIVMDGGRIVARGAPADMLAIVGPGTIGPGTIGSETISGGIPEDTARSAGSGQGLEQA
PP