Protein Info for GFF1396 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 32 to 293 (262 residues), 142.5 bits, see alignment E=7.4e-46

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 87% identity to xau:Xaut_0891)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF1396 hypothetical protein (Xanthobacter sp. DMC5)
MKAILRSRLTPLIALALIMALVPMIAPTSFHLRVAALVWIFSLAALGLTILMGYAGQVSL
GHAGFLGIGAYAVAIGPAHLGLDPLLCLLLGAVLSGLIAWLVGRPILKLKGYYLAIATLG
FGVIVALILYSETELTGGPDGMSVSRITLFGWRVTGALNWYWVSAGALLIGALIALNIAA
SPTGRALRALHDSEVAAAGAGIDVSAKKLAAFVVAAVYAAVAGGLLAAMNGLITPEAASF
SHSVELVAMVIIGGLGSVFGTVLGAAFLVVLPQTLTAFQEYEQAVLGLLIMVFMIFLPQG
IVPSLRAMIEERLP