Protein Info for GFF1391 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 365 (27 residues), see Phobius details amino acids 376 to 401 (26 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 307 (282 residues), 138.8 bits, see alignment E=2.1e-44 PF03137: OATP" amino acids 109 to 321 (213 residues), 25.9 bits, see alignment E=3.1e-10

Best Hits

KEGG orthology group: None (inferred from 86% identity to sch:Sphch_0605)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF1391 hypothetical protein (Sphingobium sp. HT1-2)
MTSQERAPDGGETQQLGTAWWMVAVLFGLYVLSWVDRLIVSMLVTPIKAHLLLSDVQVSM
ITSTSFAIFYAIFGLPLGWAADRYSRRWIIFGGVALWAVATTACGFAQSYEALLVGRIFV
GVGEAALLPAAYSLIADAFPPRLLTRATSTFQMAGKVGSATAFALGGVAIAFAAAHSGIH
IPFHGPAQPWQLVMMMVGVPGLLIALLVFTFPEPGRRGATRAARPVAEKGAIAGFVRQNW
RLLALMLVGTSCLAMCGYSMTNWVPAYIERHFGWKPVQYGVALSLMNIVSAVSLVINGWI
VDRLFTRGMTDAHLRFYSWLILGFLPVIAYMFFATNVYVFLVCYCVAQFITVPFMVYVSS
IMGLIAPATIRARMLAFFLFVFTILGLGAGPAIVAALTQYVFRSEAALGQSLAVVVTVCS
VVALLSFRMALRYLAPTIAARTVHAPAA